PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G027700.1
Common NamePHAVU_009G027700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 215aa    MW: 23416.8 Da    PI: 8.5079
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G027700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-43111101100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql+
  Phvul.009G027700.1  11 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDAVKSLAYEAEARLRDPVYGCVGLISILQHRLKQLQ 101
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++k+e
  Phvul.009G027700.1 102 TELHHAKKE 110
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.83310111IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-4411108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSSSLSSSNS PCAACKIQRR KCTQECVFAP YFPPDNPQRF AYVHKVFGAS NVAKLLNELN  60
AAQREDAVKS LAYEAEARLR DPVYGCVGLI SILQHRLKQL QTELHHAKKE LASYIGPHAM  120
LPPPPPPPPQ PRTFSLFPFK TAPPPPHQDL FAFTDDGASA SHSSHAAFNH LAVLSPTLAA  180
DHAFPHAPLH PLGLPHHQHL MLSPMQSKPQ TDPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136211.11e-154hypothetical protein PHAVU_009G027700g
SwissprotQ9FKZ33e-67LBD36_ARATH; LOB domain-containing protein 36
TrEMBLV7ASD71e-154V7ASD7_PHAVU; Uncharacterized protein
STRINGGLYMA06G11181.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-64ASYMMETRIC LEAVES 2-like 1